PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03440.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 376aa    MW: 41033.7 Da    PI: 4.7506
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03440.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.46.1e-0868113342
                      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                                    r+C+ +e+ ++ l C+ +   lC  C  + H+       H++vp+
  Zmw_sc03440.1.g00030.1.sm.mk  68 VRVCEACERMPAALACRADAAALCTICDAQVHSAnalagrHQRVPV 113
                                   689*****************************66999999*99986 PP

2CCT66.19.8e-23312355144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea++ RY+eK+k+RkFeK+irY++RK++Ae RpR+KGrF+k++
  Zmw_sc03440.1.g00030.1.sm.mk 312 REARVHRYREKKKNRKFEKTIRYATRKTYAEARPRIKGRFAKRS 355
                                   9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0132370IPR000315B-box-type zinc finger
CDDcd000214.40E-52670No hitNo description
PROSITE profilePS501198.8732870IPR000315B-box-type zinc finger
PROSITE profilePS5011911.00766113IPR000315B-box-type zinc finger
PfamPF006432.0E-668113IPR000315B-box-type zinc finger
SMARTSM003363.9E-771113IPR000315B-box-type zinc finger
PfamPF062033.7E-17312354IPR010402CCT domain
PROSITE profilePS5101716.47312354IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MNFGLSGNVF QQEVGGGGEG DCAWARPCYG CCAAPSVVYC RADAAYLCAS CDTRVHAANC  60
VASRHERVRV CEACERMPAA LACRADAAAL CTICDAQVHS ANALAGRHQR VPVLPLPAAA  120
IPAASVLAEA AAATTALGEK EEEVDSWLLL GEDSDNKNSS TNNITGNNNM YFAELDEYFD  180
LVGYNSYCDN HINNNPEQYG MQEQLQLVQK EFEDNEGSEF VVPSQVAMAN EQQQNCYGDV  240
RAEQAASTTA GVRAYTDSIS DSISFSSMEV GIVPDNMATD MTNHSILTPA GVNNLFSGSS  300
LQVPLHFSSM EREARVHRYR EKKKNRKFEK TIRYATRKTY AEARPRIKGR FAKRSDMEAE  360
VDKMFSTAAL SDVECD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002436860.11e-174hypothetical protein SORBIDRAFT_10g010050
SwissprotQ9FDX81e-149HD1_ORYSJ; Zinc finger protein HD1
TrEMBLM4ZUU11e-179M4ZUU1_SETIT; Heading date 1
STRINGSb10g010050.11e-173(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140